Recombinant Human Blood Group Kell Antigen protein (ab116891)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP23276
    • SpeciesHuman
    • SequenceMEGGDQSEEEPRERSQAGGMGTLWSQESTPEERLPVEGSRPWAVARRVLT AILILGLLLCFSVLLFYNFQNCGPRPCETSVCLDLRDHYLASGNTSVAPC TDFFSFACGRAKETNNSFQELATKNKNRLRRILEVQNSWHPGSGEEKAFQ FYNSCMDTLAIEAAGTGPLRQVIEELGGWRISGKWTSLNFNRTLRLLMSQ YGHFPFFRAYLGPHPASPHTPVIQIDQPEFDVPLKQDQEQKIYAQIFREY LTYLNQLGTLLGGDPSKVQEHSSLSISITSRLFQFLRPLEQRRAQGKLFQ MVTIDQLKEMAPAIDWLSCLQATFTPMSLSPSQSLVVHDVEYLKNMSQLV EEMLLKQRDFLQSHMILGLVVTLSPALDSQFQEARRKLSQKLRELTEQPP MPARPRWMKCVEETGTFFEPTLAALFVREAFGPSTRSAAMKLFTAIRDAL ITRLRNLPWMNEETQNMAQDKVAQLQVEMGASEWALKPELARQEYNDIQL GSSFLQSVLSCVRSLRARIVQSFLQPHPQHRWKVSPWDVNAYYSVSDHVV VFPAGLLQPPFFHPGYPRAVNFGAAGSIMAHELLHIFYQLLLPGGCLACD NHALQEAHLCLKRHYAAFPLPSRTSFNDSLTFLENAADVGGLAIALQAYS KRLLRHHGETVLPSLDLSPQQIFFRSYAQVMCRKPSPQDSHDTHSPPHLR VHGPLSSTPAFARYFRCARGALLNPSSRCQLW
    • Molecular weight107 kDa including tags
    • Amino acids1 to 732

Specifications

Our Abpromise guarantee covers the use of ab116891 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD238
    • CD238 antigen
    • ECE3
    • kel
    • Kell blood group
    • Kell blood group glycoprotein
    • Kell blood group metallo endopeptidase
    • Kell blood group metalloendopeptidase
    • KELL NULL
    • Kell protein
    • KELL_HUMAN
    see all
  • FunctionZinc endopeptidase with endothelin-3-converting enzyme activity.
  • Sequence similaritiesBelongs to the peptidase M13 family.
  • Cellular localizationCell membrane. Spans the erythrocyte membrane, and is attached to the underlying cytoskeleton.
  • Information by UniProt

Recombinant Human Blood Group Kell Antigen protein images

  • 12.5% SDS-PAGE showing ab116891 at approximately 106.59kDa stained with Coomassie Blue.

References for Recombinant Human Blood Group Kell Antigen protein (ab116891)

ab116891 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116891.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"