Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP30043
    • SpeciesHuman
    • SequenceMAVKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHV VVGDVLQAADVDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKA HGVDKVVACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLRESGLKYVAVM PPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTY PSHQYQ
    • Molecular weight22 kDa
    • Amino acids1 to 206

Specifications

Our Abpromise guarantee covers the use of ab117187 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab117187 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional notesStore at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.50
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Biliverdin IX beta reductase
    • Biliverdin reductase B
    • biliverdin reductase B (flavin reductase (NADPH))
    • Biliverdin-IX beta-reductase
    • BLVRB
    • BLVRB_HUMAN
    • BVR B
    • BVR-B
    • BVRB
    • epididymis secretory protein Li 10
    • Flavin reductase
    • Flavin reductase (NADPH)
    • FLR
    • FR
    • GHBP
    • Green heme binding protein
    • Green heme-binding protein
    • HEL-S-10
    • Methemoglobin reductase
    • MGC117413
    • NADPH dependent diaphorase
    • NADPH flavin reductase
    • NADPH-dependent diaphorase
    • NADPH-flavin reductase
    • SDR43U1
    • short chain dehydrogenase/reductase family 43U, member 1
    see all
  • FunctionBroad specificity oxidoreductase that catalyzes the NADPH-dependent reduction of a variety of flavins, such as riboflavin, FAD or FMN, biliverdins, methemoglobin and PQQ (pyrroloquinoline quinone). Contributes to heme catabolism and metabolizes linear tetrapyrroles. Can also reduce the complexed Fe(3+) iron to Fe(2+) in the presence of FMN and NADPH. In the liver, converts biliverdin to bilirubin.
  • Tissue specificityPredominantly expressed in liver and erythrocytes. At lower levels in heart, lung, adrenal gland and cerebrum.
  • Cellular localizationCytoplasm.
  • Information by UniProt

References for Recombinant Human BLVRB protein (ab117187)

ab117187 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117187.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"