Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP35226
    • SpeciesHuman
    • SequenceMHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETS KYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAA HPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKD KEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPL KDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE SDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP SGNHQSSFANRPRKASVNGSSATSSG
    • Molecular weight62 kDa including tags
    • Amino acids1 to 326

Specifications

Our Abpromise guarantee covers the use of ab114169 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B lymphoma Mo MLV insertion region (mouse)
    • B lymphoma Mo MLV insertion region 1 homolog
    • Bmi 1
    • BMI1
    • BMI1 polycomb ring finger oncogene
    • BMI1_HUMAN
    • Flvi 2/bmi 1
    • FLVI2/BMI1
    • MGC12685
    • Murine leukemia viral (bmi 1) oncogene homolog
    • Oncogene BMI 1
    • PCGF 4
    • PCGF4
    • Polycomb complex protein BMI 1
    • Polycomb complex protein BMI-1
    • Polycomb group protein Bmi1
    • Polycomb group ring finger 4
    • Polycomb group RING finger protein 4
    • RING finger protein 51
    • RNF 51
    • RNF51
    see all
  • FunctionComponent of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.
  • Sequence similaritiesContains 1 RING-type zinc finger.
  • Post-translational
    modifications
    Monoubiquitinated (By similarity). May be polyubiquitinated; which does not lead to proteasomal degradation.
  • Cellular localizationNucleus. Cytoplasm.
  • Information by UniProt

Recombinant Human Bmi1 protein images

  • ab114169 on a 12.5% SDS-PAGE Stained with Coomassie Blue.
  • Anti-Bmi1 antibody (ab63767) at 2 µg/ml + Recombinant Human Bmi1 protein (ab114169) at 0.1 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Exposure time : 30 seconds

References for Recombinant Human Bmi1 protein (ab114169)

ab114169 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114169.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"