Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQ GYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV
    • Molecular weight
      35 kDa including tags
    • Amino acids
      274 to 362

Specifications

Our Abpromise guarantee covers the use of ab116819 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BMP-8
    • BMP-8B
    • BMP8
    • Bmp8b
    • BMP8B_HUMAN
    • Bone morphogenetic protein 8
    • bone morphogenetic protein 8 (osteogenic protein 2)
    • Bone morphogenetic protein 8B
    • dJ118J21.1 (bone morphogenetic protein 8 (osteogenic protein 2))
    • OP-2
    • OP2
    • Osteogenic protein 2
    see all
  • Function
    Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116819 at approximately 35.42kDa.
    Stained with Coomassie Blue.

References

ab116819 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116819.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up