Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP34820
    • SpeciesHuman
    • SequenceKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQ GYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAV
    • Molecular weight35 kDa including tags
    • Amino acids274 to 362

Specifications

Our Abpromise guarantee covers the use of ab116819 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BMP-8
    • BMP-8B
    • BMP8
    • Bmp8b
    • BMP8B_HUMAN
    • Bone morphogenetic protein 8
    • bone morphogenetic protein 8 (osteogenic protein 2)
    • Bone morphogenetic protein 8B
    • dJ118J21.1 (bone morphogenetic protein 8 (osteogenic protein 2))
    • OP-2
    • OP2
    • Osteogenic protein 2
    see all
  • FunctionInduces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
  • Sequence similaritiesBelongs to the TGF-beta family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human BMP8b protein images

  • 12.5% SDS-PAGE showing ab116819 at approximately 35.42kDa.
    Stained with Coomassie Blue.

References for Recombinant Human BMP8b protein (ab116819)

ab116819 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116819.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"