Overview

  • Product name
    Recombinant Human BMPER protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLWFSGVGALAERYCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKC ENEGEVLQIPFITDNPCIMCVCLNKEVTCKREKCPVLSRDCALAIKQRGA CCEQCKGCTYEGNTYNSSFKWQSPAEPCVLRQCQEGVVTESGVRCVVHCK NPLEHLGMCCPTCPGCVFEGVQYQEGEEFQPEGSKCTKCSCTGGRTQCVR EVCPILSCPQHLSHIPPGQCCPKCLGQRKVFDLPFGSCLFRSDVYDNGSS FLYDNCTACTCRDSTVVCKRKCSHPGGCDQGQEGCCEECLLRVPPEDIKV CKFGNKIFQDGEMWSSINCTICACVKGRTECRNKQCIPISSCPQGKILNR KGCCPICTEKPGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASP FQVLVKNDARRTRSFSWTKSVELVLGESRVSLQQHLTVRWNGSRIALPCR APHFHIDLDGYLLKVTTKAGLEISWDGDSFVEVMAAPHLKGKLCGLCGNY NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV KVKLRAHRECQKLKSWEFQTCHSTVDYATFYRSCVTDMCECPVHKNCYCE SFLAYTRACQREGIKVHWEPQQNCAATQCKHGAVYDTCGPGCIKTCDNWN EIGPCNKPCVAGCHCPANLVLHKGRCIKPVLCPQR
    • Amino acids
      1 to 685
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BMP binding endothelial regulator
    • BMP binding endothelial regulator precursor protein
    • BMP-binding endothelial regulator protein
    • BMPER
    • BMPER_HUMAN
    • Bone morphogenetic protein binding endothelial cell precursor derived regulator
    • Bone morphogenetic protein-binding endothelial cell precursor-derived regulator
    • CRIM3
    • Crossveinless 2
    • CV 2
    • CV2
    • hCV2
    • Protein crossveinless 2
    • Protein crossveinless-2
    see all
  • Function
    Inhibitor of bone morphogenetic protein (BMP) function, it may regulate BMP responsiveness of osteoblasts and chondrocytes.
  • Tissue specificity
    Highly expressed in lung, and brain and also in primary chondrocytes.
  • Involvement in disease
    Defects in BMPER are the cause of diaphanospondylodysostosis (DSD) [MIM:608022]. A rare, recessively inherited, perinatal lethal skeletal disorder. The primary skeletal characteristics of the phenotype include a small chest, abnormal vertebral segmentation, and posterior rib gaps containing incompletely differentiated mesenchymal tissue. Consistent craniofacial features include ocular hypertelorism, epicanthal folds, a depressed nasal bridge with a short nose, and low-set ears. The most commonly described extraskeletal finding is nephroblastomatosis with cystic kidneys, but other visceral findings have been described in some cases.
  • Sequence similarities
    Contains 1 TIL (trypsin inhibitory-like) domain.
    Contains 5 VWFC domains.
    Contains 1 VWFD domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab165805 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up