Overview

Description

  • Nature
    Recombinant
  • Source
    Insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAIN NTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIE CCRTNLCNQYLQPTLPPVVIGPFFDGSIRHHHHHH
    • Molecular weight
      23 kDa
    • Amino acids
      24 to 152
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab55202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 90 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Buffer: None

  • Reconstitution
    Reconstitute in water or PBS to make a solution of no less than 100 µg/ml of BMPRIA.

General Info

  • Alternative names
    • 10q23del
    • Activin A receptor type II like kinase 3
    • Activin receptor like kinase 3
    • Activin receptor-like kinase 3
    • ACVRLK 3
    • ACVRLK3
    • ALK 3
    • ALK-3
    • ALK3
    • BMP type-1A receptor
    • Bmpr
    • BMPR 1A
    • BMPR-1A
    • Bmpr1a
    • BMR1A_HUMAN
    • Bone morphogenetic protein receptor type IA
    • Bone morphogenetic protein receptor type IA precursor
    • Bone morphogenetic protein receptor type-1A
    • BR 1a
    • BR1a
    • CD 292
    • CD292
    • CD292 antigen
    • EC 2.7.11.30
    • Serine threonine protein kinase receptor R5
    • Serine threonine protein kinase receptor R5 precursor
    • Serine/threonine-protein kinase receptor R5
    • SKR 5
    • SKR5
    • zBMPR IA
    • zBMPRIA
    see all
  • Function
    On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP2, BMP4, GDF5 and GDF6. Positively regulates chondrocyte differentiation through GDF5 interaction. Mediates induction of adipogenesis by GDF6.
  • Tissue specificity
    Highly expressed in skeletal muscle.
  • Involvement in disease
    Juvenile polyposis syndrome
    Polyposis syndrome, mixed hereditary 2
    A microdeletion of chromosome 10q23 involving BMPR1A and PTEN is a cause of chromosome 10q23 deletion syndrome, which shows overlapping features of the following three disorders: Bannayan-Zonana syndrome, Cowden disease and juvenile polyposis syndrome.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 GS domain.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab55202 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab55202.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up