Overview

Description

  • NatureRecombinant
  • SourceInsect cells
  • Amino Acid Sequence
    • AccessionP36894
    • SpeciesHuman
    • SequenceQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAIN NTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIE CCRTNLCNQYLQPTLPPVVIGPFFDGSIRHHHHHH
    • Molecular weight23 kDa
    • Amino acids24 to 152
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab55202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 90 % SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Buffer: None

  • ReconstitutionReconstitute in water or PBS to make a solution of no less than 100 µg/ml of BMPRIA.

General Info

  • Alternative names
    • 10q23del
    • Activin A receptor type II like kinase 3
    • Activin receptor like kinase 3
    • Activin receptor-like kinase 3
    • ACVRLK 3
    • ACVRLK3
    • ALK 3
    • ALK-3
    • ALK3
    • BMP type-1A receptor
    • Bmpr
    • BMPR 1A
    • BMPR-1A
    • Bmpr1a
    • BMR1A_HUMAN
    • Bone morphogenetic protein receptor type IA
    • Bone morphogenetic protein receptor type IA precursor
    • Bone morphogenetic protein receptor type-1A
    • BR 1a
    • BR1a
    • CD 292
    • CD292
    • CD292 antigen
    • EC 2.7.11.30
    • Serine threonine protein kinase receptor R5
    • Serine threonine protein kinase receptor R5 precursor
    • Serine/threonine-protein kinase receptor R5
    • SKR 5
    • SKR5
    • zBMPR IA
    • zBMPRIA
    see all
  • FunctionOn ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP2, BMP4, GDF5 and GDF6. Positively regulates chondrocyte differentiation through GDF5 interaction. Mediates induction of adipogenesis by GDF6.
  • Tissue specificityHighly expressed in skeletal muscle.
  • Involvement in diseaseJuvenile polyposis syndrome
    Polyposis syndrome, mixed hereditary 2
    A microdeletion of chromosome 10q23 involving BMPR1A and PTEN is a cause of chromosome 10q23 deletion syndrome, which shows overlapping features of the following three disorders: Bannayan-Zonana syndrome, Cowden disease and juvenile polyposis syndrome.
  • Sequence similaritiesBelongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 GS domain.
    Contains 1 protein kinase domain.
  • Cellular localizationMembrane.
  • Information by UniProt

References for Recombinant Human BMPR1A protein (ab55202)

ab55202 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab55202.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"