Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRRRPPSRGGRGAARARETRRQPRHRSGRRMAEAISCTLNCSCQSFKPGK INHRQCDQCKHGWVAHALSKLRIPPMYPTSQVEIVQSNVVFDISSLMLYG TQAIPVRLKILLDRLFSVLKQDEVLQILHALDWTLQDYIRGYVLQDASGK VLDHWSIMTSEEEVATLQQFLRFGETKSIVELMAIQEKEEQSIIIPPSTA NVDIRAFIESCSHRSSSLPTPVDKGNPSSIHPFENLISNMTFMLPFQFFN PLPPALIGSLPEQYMLEQGHDQSQDPKQEVHGPFPDSSFLTSSSTPFQVE KDQCLNCPDAITKKEDSTHLSDSSSYNIVTKFERTQLSPEAKVKPERNSL GTKKGRVFCTACEKTFYDKGTLKIHYNAVHLKIKHKCTIEGCNMVFSSLR SRNRHSANPNPRLHMPMNRNNRDKDLRNSLNLASSENYKCPGFTVTSPDC RPPPSYPGSGEDSKGQPAFPNIGQNGVLFPNLKTVQPVLPFYRSPATPAE VANTPGILPSLPLLSSSIPEQLISNEMPFDALPKKKSRKSSMPIKIEKEA VEIANEKRHNLSSDEDMPLQVVSEDEQEACSPQSHRVSEEQHVQSGGLGK PFPEGERPCHRESVIESSGAISQTPEQATHNSERETEQTPALIMVPREVE DGGHEHYFTPGMEPQVPFSDYMELQQRLLAGGLFSALSNRGMAFPCLEDS KELEHVGQHALARQIEENRFQCDICKKTFKNACSVKIHHKNMHVKEMHTC TVEGCNATFPSRRSRDRHSSNLNLHQKALSQEALESSEDHFRAAYLLKDV AKEAYQDVAFTQQASQTSVIFKGTSRMGSLVYPITQVHSASLESYNSGPL SEGTILDLSTTSSMKSESSSHSSWDSDGVSEEGTVLMEDSDGNCEGSSLV PGEDEYPICVLMEKADQSLASLPSGLPITCHLCQKTYSNKGTFRAHYKTV HLRQLHKCKVPGCNTMFSSVRSRNRHSQNPNLHKSLASSPSHLQ
    • Amino acids
      1 to 994
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157965 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI047752
    • AW546376
    • basonuclin 1
    • BNC
    • Bnc1
    • BNC1_HUMAN
    • BSN1
    • HsT19447
    • zinc finger protein basonuclin
    • Zinc finger protein basonuclin-1
    see all
  • Function
    Likely to be a transcription factor specific for squamous epithelium and for the constituent keratinocytes at a stage either prior to or at the very beginning of terminal differentiation. May play a role in the differentiation of spermatozoa and oocytes.
  • Tissue specificity
    Expressed in epidermis, testis and foreskin, and to a lower extent in thymus, spleen, mammary glands, placenta, brain and heart.
  • Sequence similarities
    Contains 6 C2H2-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylation on Ser-537 and Ser-541 leads to cytoplasmic localization.
  • Cellular localization
    Nucleus. Cytoplasm. Relocates to the midpiece of the flagellum during late spermiogenesis in spermatids.
  • Information by UniProt

Images

  • ab157965 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157965 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157965.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up