Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ12981
    • SpeciesHuman
    • SequenceMAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEK FQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANL TCKI
    • Molecular weight50 kDa including tags
    • Amino acids1 to 228

Specifications

Our Abpromise guarantee covers the use of ab116866 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCL2 adenovirus E1B 19kD interacting protein 1
    • BCL2/adenovirus E1B 19 kDa protein-interacting protein 1
    • BNIP1
    • MGC41600
    • Nip1
    • OTTHUMP00000161077
    • OTTHUMP00000161078
    • OTTHUMP00000161079
    • OTTHUMP00000223580
    • sec20
    • SEC20_HUMAN
    • SEC20L
    • Transformation-related gene 8 protein
    • TRG-8
    • TRG8
    • Vesicle transport protein SEC20
    see all
  • FunctionSNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER. Required for maintenance of ER network. Implicated in the suppression of cell death.
  • Tissue specificityIsoform 1 is highly expressed in heart, brain, liver skeletal muscle and pancreas. Isoform 3 is moderately expressed in placenta, lung and kidney. Isoform 4 is highly expressed in testis and small intestine.
  • Sequence similaritiesBelongs to the SEC20 family.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human BNIP1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116866 at approximately 50.49 kDa.

References for Recombinant Human BNIP1 protein (ab116866)

ab116866 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116866.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"