Recombinant Human BNIP3L protein (ab114290)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO60238
    • SpeciesHuman
    • SequenceSSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSH CDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE
    • Molecular weight35 kDa including tags
    • Amino acids43 to 130

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adenovirus E1B19k binding protein B5
    • Adenovirus E1B19K-binding protein B5
    • BCL2/adenovirus E1B 19 kd protein interacting protein 3a
    • BCL2/adenovirus E1B 19 kDa protein interacting protein 3A
    • BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
    • BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A
    • BCL2/adenovirus E1B 19kDa interacting protein 3 like
    • BNI3L_HUMAN
    • BNIP3a
    • BNIP3H
    • BNIP3L
    • BNIP3L protein
    • NIP3 like protein X
    • NIP3-like protein X
    • NIP3L
    • NIX
    see all
  • FunctionInduces apoptosis. Interacts with viral and cellular anti-apoptosis proteins. Can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. May function as a tumor suppressor. Inhibits apoptosis induced by BNIP3.
  • Sequence similaritiesBelongs to the NIP3 family.
  • Post-translational
    modifications
    Undergoes progressive proteolysis to an 11 kDa C-terminal fragment, which is blocked by the proteasome inhibitor lactacystin.
  • Cellular localizationNucleus envelope. Endoplasmic reticulum. Mitochondrion. Membrane.
  • Information by UniProt

Recombinant Human BNIP3L protein images

  • ab114290 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human BNIP3L protein (ab114290)

ab114290 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"