Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMLWQKPTAPEQAPAPARPYQGVRVKEPVKE LLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEE AALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPS YTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWP QPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSL TIDKLLLEEEDSDAYALNHTLSVEGF
    • Molecular weight
      30 kDa including tags
    • Amino acids
      1 to 256
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • B cell Oct binding protein 1
    • B cell specific coactivator OBF 1
    • B cell specific coactivator OBF1
    • B-cell-specific coactivator OBF-1
    • BOB 1
    • BOB-1
    • OBF 1
    • OBF1
    • OBF1_HUMAN
    • OCA B
    • OCA-B
    • OCAB
    • OCT binding factor 1
    • OCT-binding factor 1
    • POU class 2 associating factor 1
    • POU domain class 2 associating factor 1
    • POU domain class 2-associating factor 1
    • Pou2af1
    see all
  • Function
    Transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of OCT1 and OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers.
  • Tissue specificity
    B-cell specific.
  • Involvement in disease
    Note=A chromosomal aberration involving POU2AF1/OBF1 may be a cause of a form of B-cell leukemia. Translocation t(3;11)(q27;q23) with BCL6.
  • Sequence similarities
    Belongs to the POU2AF1 family.
  • Post-translational
    modifications
    Ubiquitinated; mediated by SIAH1 or SIAH2 and leading to its subsequent proteasomal degradation.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE (3 µg)

References

ab109849 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up