Recombinant Human Bok protein (ab116985)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UMX3
    • SpeciesHuman
    • SequenceMEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSW SAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEP VVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALV DCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRF LKAAFFVLLPER
    • Molecular weight50 kDa including tags
    • Amino acids1 to 212

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bcl 2 related ovarian killer protein
    • Bcl-2-like protein 9
    • Bcl-2-related ovarian killer protein
    • BCL2 related ovarian killer
    • Bcl2-L-9
    • BCL2L9
    • BOK
    • BOK_HUMAN
    • BOKL
    • Hbok
    • MGC4631
    see all
  • FunctionMay play a role in apoptosis.
  • Tissue specificityExpressed in brain, liver, appendix and lymphoid tissues.
  • Sequence similaritiesBelongs to the Bcl-2 family.
  • Information by UniProt

Recombinant Human Bok protein images

  • 12.5% SDS-PAGE showing ab116985 at approximately 50.30 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Bok protein (ab116985)

ab116985 has not yet been referenced specifically in any publications.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"