Recombinant Human Borealin/CDCA8 protein (ab107144)

Overview

  • Product nameRecombinant Human Borealin/CDCA8 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ53HL2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMRKLASFLKDFDREVEIRIKQIESDRQNLL KEVDNLYNIEILRLPKALREMNWLDYFALGGNKQALEEAATADLDITEIN KLTAEAIQTPLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPP SKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSRVF KTPGLRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQ RHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK
    • Molecular weight32 kDa including tags
    • Amino acids19 to 280
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 50% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • BOR
    • BOREA_HUMAN
    • Borealin
    • CDCA8
    • Cell division cycle associated 8
    • cell division cycle associated protein 8
    • Cell division cycle-associated protein 8
    • Dasra B
    • Dasra-B
    • DasraB
    • FLJ10468
    • FLJ12042
    • hDasra B
    • hDasra-B
    • MESRGP
    • OTTHUMP00000004514
    • pluripotent embryonic stem cell related gene 3 protein
    • Pluripotent embryonic stem cell-related gene 3 protein
    see all
  • FunctionComponent of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. In the complex, it may be required to direct the CPC to centromeric DNA. Major effector of the TTK kinase in the control of attachment-error-correction and chromosome alignment.
  • Sequence similaritiesBelongs to the borealin family.
  • Developmental stageCell-cycle regulated. Increases during G2/M phase and then reduces after exit from M phase.
  • DomainThe C-terminal region (aa 207-280) represents the dimerization motif.
  • Post-translational
    modifications
    Phosphorylated by TTK, essentially at Thr-88, Thr94, Thr-169 and Thr-230.
    Sumoylated by UBE2I and RANBP2. Desumoylated by SENP3 through the removal of SUMO2 and SUMO3.
  • Cellular localizationNucleus > nucleolus. Cytoplasm. Cytoplasm > cytoskeleton > spindle. Chromosome > centromere. Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalizes with SENP3 in the nucleolus in interphase cells.
  • Information by UniProt

Recombinant Human Borealin/CDCA8 protein images

  • ab107144 at 3 µg analysed by 15% SDS PAGE.

References for Recombinant Human Borealin/CDCA8 protein (ab107144)

ab107144 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"