Recombinant Human BORIS protein (ab112433)

Overview

  • Product name
    Recombinant Human BORIS protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEKAK STKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLK T
    • Molecular weight
      37 kDa including tags
    • Amino acids
      193 to 293
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • BORIS like protein
    • Brother of the regulator of imprinted sites
    • Cancer/testis antigen 27
    • CCCTC binding factor (zinc finger protein) like
    • CCCTC-binding factor
    • CT27
    • CTCF paralog
    • CTCF T
    • CTCF-like protein
    • Ctcfl
    • CTCFL_HUMAN
    • dJ579F20.2
    • HMG 1L1
    • HMGB1L1
    • MGC163358
    • MGC169105
    • MGC169106
    • Putative high mobility group protein 1 like 1
    • Putative high mobility group protein B1 like 1
    • Transcriptional repressor CTCFL
    • Zinc finger protein CTCF-T
    see all
  • Function
    Testis-specific DNA binding protein responsible for insulator function, nuclear architecture and transcriptional control, which probably acts by recruiting epigenetic chromatin modifiers. Plays a key role in gene imprinting in male germline, by participating in the establishment of differential methylation at the IGF2/H19 imprinted control region (ICR). Directly binds the unmethylated H19 ICR and recruits the PRMT7 methyltransferase, leading to methylate histone H4 'Arg-3' to form H4R3sme2. This probably leads to recruit de novo DNA methyltransferases at these sites (By similarity). Seems to act as tumor suppressor. In association with DNMT1 and DNMT3B, involved in activation of BAG1 gene expression by binding to its promoter. Required for dimethylation of H3 lysine 4 (H3K4me2) of MYC and BRCA1 promoters.
  • Tissue specificity
    Testis specific. Specifically expressed in primary spermatocytes.
  • Sequence similarities
    Belongs to the CTCF zinc-finger protein family.
    Contains 11 C2H2-type zinc fingers.
  • Developmental stage
    Is up-regulated in primary spermatocytes (expression overlapping with the genome-wide erasure of methylation) to become silenced on activation of CTCF in post-meiotic germline cells (expression corresponding to DNA remethylation).
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human BORIS protein images

  • ab112433 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human BORIS protein (ab112433)

ab112433 has not yet been referenced specifically in any publications.

Product Wall


ab112433 has an N-terminal GST tag.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up