Recombinant Human BPGM protein (BSA and azide free) (ab173072)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSKYKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNF EFDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNR EQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLD QLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLE GISDEDIINITLPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVED QGKVKQAKKL EHHHHHH
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 259
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173072 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.24% Tris, 0.02% DTT

General Info

  • Alternative names
    • 2
    • 2,3-bisphosphoglycerate mutase
    • 2,3-bisphosphoglycerate mutase, erythrocyte
    • 2,3-bisphosphoglycerate synthase
    • 2,3-diphosphoglycerate mutase
    • 3-bisphosphoglycerate mutase
    • 3-bisphosphoglycerate synthase
    • 3-diphosphoglycerate mutase
    • Ab2 098
    • AI323730
    • AL022789
    • Bisphosphoglycerate mutase
    • BPG dependent PGAM
    • BPG-dependent PGAM
    • Bpgm
    • C86192
    • DPGM
    • erythrocyte
    • Erythrocyte 2,3 bisphosphoglycerate mutase
    • PMGE_HUMAN
    see all
  • Function
    Plays a major role in regulating hemoglobin oxygen affinity by controlling the levels of 2,3-bisphosphoglycerate (2,3-BPG). Also exhibits mutase (EC 5.4.2.1) and phosphatase (EC 3.1.3.13) activities.
  • Involvement in disease
    Defects in BPGM are the cause of bisphosphoglycerate mutase deficiency (BPGMD) [MIM:222800]. A disease characterized by hemolytic anemia, splenomegaly, cholelithiasis and cholecystitis.
  • Sequence similarities
    Belongs to the phosphoglycerate mutase family. BPG-dependent PGAM subfamily.
  • Post-translational
    modifications
    Glycation of Lys-159 in diabetic patients inactivates the enzyme.
  • Information by UniProt

References

ab173072 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173072.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up