Overview

  • Product name
    Recombinant Human BPHL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSVTSAKVAVNGVQLHYQQTGEGDHAVLLL PGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFER DAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANA YVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQF KHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHL MPEGKHNLHLRFADEFNKLAEDFLQ
    • Molecular weight
      31 kDa including tags
    • Amino acids
      38 to 291
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab103498 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Biphenyl hydrolase like
    • Biphenyl hydrolase related
    • biphenyl hydrolase-like (serine hydrolase)
    • Biphenyl hydrolase-like protein
    • Biphenyl hydrolase-related protein
    • Bph-rp
    • Bphl
    • BPHL_HUMAN
    • Bphrp
    • Breast epithelial mucin associated antigen
    • Breast epithelial mucin-associated antigen
    • MCNAA
    • Mucin-associated antigen
    • VACVase
    • Valacyclovir hydrolase
    • Valacyclovirase
    see all
  • Function
    Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.
  • Tissue specificity
    Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle.
  • Sequence similarities
    Belongs to the AB hydrolase superfamily. Lipase family.
  • Information by UniProt

Recombinant Human BPHL protein images

  • 15% SDS-PAGE analysis of 3µg ab103498.

References for Recombinant Human BPHL protein (ab103498)

ab103498 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up