Overview

  • Product name
    Recombinant Human BPHL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSVTSAKVAVNGVQLHYQQTGEGDHAVLLL PGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFER DAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANA YVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQF KHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHL MPEGKHNLHLRFADEFNKLAEDFLQ
    • Molecular weight
      31 kDa including tags
    • Amino acids
      38 to 291
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab103498 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Biphenyl hydrolase like
    • Biphenyl hydrolase related
    • biphenyl hydrolase-like (serine hydrolase)
    • Biphenyl hydrolase-like protein
    • Biphenyl hydrolase-related protein
    • Bph-rp
    • Bphl
    • BPHL_HUMAN
    • Bphrp
    • Breast epithelial mucin associated antigen
    • Breast epithelial mucin-associated antigen
    • MCNAA
    • Mucin-associated antigen
    • VACVase
    • Valacyclovir hydrolase
    • Valacyclovirase
    see all
  • Function
    Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.
  • Tissue specificity
    Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle.
  • Sequence similarities
    Belongs to the AB hydrolase superfamily. Lipase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103498.

References

ab103498 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up