Overview

  • Product name
    Recombinant Human BPIL3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLRILCLALCSLLTGTRADPGALLRLGMDIMNQVQSAMDESHILEKMAAE AGKKQPGMKPIKGITNLKVKDVQLPVITLNFVPGVGIFQCVSTGMTVTGK SFMGGNMEIIVALNITATNRLLRDEETGLPVFKSEGCEVILVNVKTNLPS NMLPKMVNKFLDSTLHKVLPGLMCPAIDAVLVYVNRKWTNLSDPMPVGQM GTVKYVLMSAPATTASYIQLDFSPVVQQQKGKTIKLADAGEALTFPEGYA KGSSQLLLPATFLSAELALLQKSFHVNIQDTMIGELPPQTTKTLARFIPE VAVAYPKSKPLTTQIKIKKPPKVTMKTGKSLLHLHSTLEMFAARWRSKAP MSLFLLEVHFNLKVQYSVHENQLQMATSLDRLLSLSRKSSSIGNFNEREL TGFITSYLEEAYIPVVNDVLQVGLPLPDFLAMNYNLAELDIVENALMLDL KLG
    • Amino acids
      1 to 453
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bactericidal/permeability increasing protein like 3
    • Bactericidal/permeability-increasing protein-like 3
    • BPI fold-containing family B member 6
    • BPIB6_HUMAN
    • Bpifb6
    • BPIL 3
    • LPLUNC6
    • OTTHUMP00000030617
    see all
  • Tissue specificity
    Detected at very low levels in normal tonsils, and at higher levels in hypertrophic tonsils.
  • Sequence similarities
    Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab165308 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165308.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up