Overview

  • Product nameRecombinant Human BPNT1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95861
    • SpeciesHuman
    • SequenceMRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMASSNTVLMRLVAS AYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLAR KFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVV WVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAV LGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDA VLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTD IHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP
    • Molecular weight38 kDa including tags
    • Amino acids1 to 308
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab103057 was purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • 3''(2'')
    • 3'(2') 5' bisphosphate nucleotidase 1
    • 4-phosphatase
    • 5''-bisphosphate nucleotidase 1
    • Bisphosphate 3 prime nucleotidase
    • Bisphosphate 3' nucleotidase
    • Bisphosphate 3' nucleotidase 1
    • Bisphosphate 3''-nucleotidase 1
    • Bpnt1
    • BPNT1_HUMAN
    • BPntase
    • PAP inositol 1,4 phosphatase
    • PAP-inositol-1
    • PIP
    see all
  • FunctionConverts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6.
  • Tissue specificityHighly expressed in kidney, liver, pancreas and heart. Detected at lower levels in brain, placenta, lung and skeletal muscle.
  • Sequence similaritiesBelongs to the inositol monophosphatase family.
  • Information by UniProt

Recombinant Human BPNT1 protein images

  • 15% SDS-PAGE (3 µg)

References for Recombinant Human BPNT1 protein (ab103057)

ab103057 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"