Overview

  • Product name
    Recombinant Human BPNT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMASSNTVLMRLVAS AYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLAR KFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVV WVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAV LGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDA VLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTD IHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 308
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab103057 was purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • 3''(2'')
    • 3'(2') 5' bisphosphate nucleotidase 1
    • 4-phosphatase
    • 5''-bisphosphate nucleotidase 1
    • Bisphosphate 3 prime nucleotidase
    • Bisphosphate 3' nucleotidase
    • Bisphosphate 3' nucleotidase 1
    • Bisphosphate 3''-nucleotidase 1
    • Bpnt1
    • BPNT1_HUMAN
    • BPntase
    • PAP inositol 1,4 phosphatase
    • PAP-inositol-1
    • PIP
    see all
  • Function
    Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6.
  • Tissue specificity
    Highly expressed in kidney, liver, pancreas and heart. Detected at lower levels in brain, placenta, lung and skeletal muscle.
  • Sequence similarities
    Belongs to the inositol monophosphatase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE (3 µg)

References

ab103057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up