Recombinant Human Brachyury / Bry protein (ab114236)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO15178
    • SpeciesHuman
    • SequenceERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLP STHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW
    • Molecular weight37 kDa including tags
    • Amino acids222 to 320

Specifications

Our Abpromise guarantee covers the use of ab114236 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BRAC_HUMAN
    • Brachyury homolog
    • Brachyury protein
    • Bry
    • MGC104817
    • Protein T
    • SAVA
    • T
    • T brachyury homolog
    • T brachyury transcription factor
    • T Protein
    • T, brachyury homolog (mouse)
    • TFT
    • Transcription factor T
    see all
  • FunctionInvolved in the transcriptional regulation of genes required for mesoderm formation and differentiation. Binds to a palindromic site (called T site) and activates gene transcription when bound to such a site.
  • Involvement in diseaseGenetic variations in T are associated with susceptibility to neural tube defects (NTD) [MIM:182940]. NTD are common congenital malformations. Spina bifida, which results from malformations in the caudal region of the neural tube, is compatible with life but associated with significant morbidity, including lower limb paralysis.
    T is involved in susceptibility to the development of chordoma (CHDM) [MIM:215400]. Chordomas are rare, clinically malignant tumors derived from notochordal remnants. They occur along the length of the spinal axis, predominantly in the sphenooccipital, vertebral and sacrococcygeal regions. They are characterized by slow growth, local destruction of bone, extension into adjacent soft tissues and rarely, distant metastatic spread. Note=Susceptibility to development of chordomas is due to a T gene duplication.
  • Sequence similaritiesContains 1 T-box DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Brachyury / Bry protein images

  • 12.5% SDS-PAGE showing ab114236 at approximately 36.52kDa stained with Coomassie Blue.

References for Recombinant Human Brachyury / Bry protein (ab114236)

ab114236 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114236.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"