Overview

Description

  • NatureRecombinant
  • SourceBaculovirus
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFC KFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQ LDTGLEYA NSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSL SVQLSNLG TVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQ GTRDEISL DSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSN LHVEPCGT NTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKE TCNDRRTP STEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNE WFSRSDEL LGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALIC KSERVHSK SVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTN KLKRKRRP TSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTK GDSIQNEK NPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSS TRHIHALE LVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEP ATGAKKSN KPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKE EKLETVKV SNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVST LGKAKTEP NKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEME ESELDAQY LQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQK EENQGKNE SNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETG LITPNKHG LLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPST VSTISRNN IRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKL NAMLRLGV LQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMG SSHASQVC SETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHT HLAQGYRR GAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSK NTEENLLS LKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNT QDPFLIGS SKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAAS GCESETSV SEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNS YPSIISDS SALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTS KNKEPGVE RSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGP HDLTETSY LPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKV PQLKVAES AQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPE EFMLVYKF ARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFW VTQSIKER KMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMP TDQLEWMV QLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVT REWVLDSV ALYQCQELDTYLIPQIPHSHY
    • Molecular weight209 kDa
    • Amino acids1 to 1863

Specifications

Our Abpromise guarantee covers the use of ab82204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris Cl, 100mM Potassium chloride, 1mM DTT, 0.2mM EDTA, pH 8.0

General Info

  • Alternative names
    • BRCA 1
    • BRCA1
    • BRCA1/BRCA2 containing complex subunit 1
    • BRCA1/BRCA2-containing complex, subunit 1
    • BRCA1_HUMAN
    • BRCAI
    • BRCC 1
    • BRCC1
    • Breast and ovarian cancer susceptibility protein 1
    • Breast Cancer 1
    • Breast Cancer 1 Early Onset
    • Breast cancer type 1 susceptibility protein
    • BROVCA1
    • IRIS
    • PNCA4
    • PPP1R53
    • Protein phosphatase 1 regulatory subunit 53
    • PSCP
    • RING finger protein 53
    • RNF53
    see all
  • FunctionE3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule nucleation. Required for normal cell cycle progression from G2 to mitosis. Required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. Involved in transcriptional regulation of P21 in response to DNA damage. Required for FANCD2 targeting to sites of DNA damage. May function as a transcriptional regulator. Inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation. Contributes to homologous recombination repair (HRR) via its direct interaction with PALB2, fine-tunes recombinational repair partly through its modulatory role in the PALB2-dependent loading of BRCA2-RAD51 repair machinery at DNA breaks.
  • Tissue specificityIsoform 1 and isoform 3 are widely expressed. Isoform 3 is reduced or absent in several breast and ovarian cancer cell lines.
  • PathwayProtein modification; protein ubiquitination.
  • Involvement in diseaseDefects in BRCA1 are a cause of susceptibility to breast cancer (BC) [MIM:114480]. A common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case. Note=Mutations in BRCA1 are thought to be responsible for 45% of inherited breast cancer. Moreover, BRCA1 carriers have a 4-fold increased risk of colon cancer, whereas male carriers face a 3-fold increased risk of prostate cancer. Cells lacking BRCA1 show defects in DNA repair by homologous recombination.
    Defects in BRCA1 are a cause of susceptibility to breast-ovarian cancer familial type 1 (BROVCA1) [MIM:604370]. A condition associated with familial predisposition to cancer of the breast and ovaries. Characteristic features in affected families are an early age of onset of breast cancer (often before age 50), increased chance of bilateral cancers (cancer that develop in both breasts, or both ovaries, independently), frequent occurrence of breast cancer among men, increased incidence of tumors of other specific organs, such as the prostate. Note=Mutations in BRCA1 are thought to be responsible for more than 80% of inherited breast-ovarian cancer.
    Defects in BRCA1 are a cause of genetic susceptibility to ovarian cancer [MIM:113705].
  • Sequence similaritiesContains 2 BRCT domains.
    Contains 1 RING-type zinc finger.
  • DomainThe BRCT domains recognize and bind phosphorylated pSXXF motif on proteins. The interaction with the phosphorylated pSXXF motif of FAM175A/Abraxas, recruits BRCA1 at DNA damage sites.
    The RING-type zinc finger domain interacts with BAP1.
  • Post-translational
    modifications
    Phosphorylation at Ser-308 by STK6/AURKA is required for normal cell cycle progression from G2 to mitosis. Phosphorylated in response to IR, UV, and various stimuli that cause checkpoint activation, probably by ATM or ATR.
    Autoubiquitinated, undergoes 'Lys-6'-linked polyubiquitination. 'Lys-6'-linked polyubiquitination does not promote degradation.
  • Cellular localizationCytoplasm; Nucleus. Localizes at sites of DNA damage at double-strand breaks (DSBs) and recruitment to DNA damage sites is mediated by the BRCA1-A complex.
  • Information by UniProt

References for Recombinant Human BRCA1 protein (ab82204)

This product has been referenced in:

See 1 Publication for this product

Product Wall

The Histagged BRCA1 was expressed in baculovirus and suspended in 1000mM salt buffer for sonication lysis. A clear supernatant was mixed with the Ni-Sepharose resin and purified by imidazole gradient on FPLC system. SEC HPLC was used to further purify ...

Read More

Thank you for contacting us.

I am sorry to hear of this issue. I would definitely not expect the purified protein to have multiple bands unless there was degradation or cleavage. Were you able to do Coomassie blue staining? Did the results...

Read More

Thank you for your reply with this requested information.


I would like to clarify one more detail regarding your protocol. You mention you are using a commercially available antibody. Are you seeing these different results with the exact...

Read More

Thanks for your call and for bringing this to my attention.

I have found that the correct concentration is 0.4mg/ml, not 0.25mg/ml.

I hope this is helpful. Please contact me again if you have any further questions.

Thank you for contacting Abcam.

We do not currently have any BRCA1ELISA kitsin our catalogue, but we if you were to place a bulk order for ab82204, then all of the vials should be at the same concentration and we could also work with you to ma...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"