Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVP AVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS
    • Molecular weight
      36 kDa including tags
    • Amino acids
      167 to 256

Specifications

Our Abpromise guarantee covers the use of ab114383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114383 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BRD 2
    • Brd2
    • BRD2_HUMAN
    • Bromodomain containing 2
    • Bromodomain-containing protein 2
    • D6S113E
    • DKFZp686N0336
    • Female sterile homeotic related gene 1
    • Female sterile homeotic related gene 1, mouse, homolog of
    • FLJ31942
    • FSH
    • FSRG1
    • KIAA9001
    • NAT
    • O27.1.1
    • Really interesting new gene 3 protein
    • RING3
    • RING3 PROTEIN
    • RNF3
    see all
  • Function
    May play a role in spermatogenesis or folliculogenesis.
  • Sequence similarities
    Contains 2 bromo domains.
    Contains 1 ET domain.
  • Domain
    One bromodomain is sufficient for a partial interaction with histone H4 acetylated at 'Lys-13'.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human BRD2 protein images

  • ab114383 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human BRD2 protein (ab114383)

ab114383 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up