Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QSSKKGKLSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHD IIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAM ARKLQDVFEFRYAKMPDEPLE
    • Molecular weight
      15 kDa including tags
    • Amino acids
      339 to 459
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Bromdomain 2

Specifications

Our Abpromise guarantee covers the use of ab196121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Additional notes

    ab196121 is useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.79% Tris HCl, 0.8% Sodium chloride, 0.02% Potassium chloride, 0.05% Tween, 10% Glycerol

General Info

  • Alternative names
    • BRD 2
    • Brd2
    • BRD2_HUMAN
    • Bromodomain containing 2
    • Bromodomain-containing protein 2
    • D6S113E
    • DKFZp686N0336
    • Female sterile homeotic related gene 1
    • Female sterile homeotic related gene 1, mouse, homolog of
    • FLJ31942
    • FSH
    • FSRG1
    • KIAA9001
    • NAT
    • O27.1.1
    • Really interesting new gene 3 protein
    • RING3
    • RING3 PROTEIN
    • RNF3
    see all
  • Function
    May play a role in spermatogenesis or folliculogenesis.
  • Sequence similarities
    Contains 2 bromo domains.
    Contains 1 ET domain.
  • Domain
    One bromodomain is sufficient for a partial interaction with histone H4 acetylated at 'Lys-13'.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE with Coomassie stain.

    Lane 1: 4.2 µg Human BRD2 protein fragment (ab196121)
    Lane 2: Protein marker

  • ab196121 is incubated with biotinylated acetyl-histone peptide substrate in assay buffer in a 10 µl reaction for 1 hour at RT. Proprietary Nickel Chelate acceptor beads are added, followed by proprietary Streptavidin-conjugated donor beads. After 1 hour minute incubation at RT, signal is measured.

References

ab196121 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up