Recombinant Human BRD3 protein (Tagged) (ab176951)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDY HKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIV LMAQALEKIFLQKVAQMPQEE
    • Molecular weight
      41 kDa including tags
    • Amino acids
      21 to 144
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab176951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • BRD 3
    • Brd3
    • BRD3_HUMAN
    • Bromodomain containing 3
    • Bromodomain containing protein 3
    • Bromodomain-containing protein 3
    • KIAA0043
    • Open reading frame X
    • ORFX
    • RING3 like gene
    • RING3-like protein
    • RING3L
    see all
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Note=A chromosomal aberration involving BRD3 is found in a rare, aggressive, and lethal carcinoma arising in midline organs of young people. Translocation t(15;9)(q14;q34) with NUT which produces a BRD3-NUT fusion protein.
  • Sequence similarities
    Contains 2 bromo domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab176951
    Lane 1: Markers:
    Lane 2: ab176951 (2 μg)
    Lane 3: ab176951 (5 μg)
    Lane 4: ab176951 (10 μg)

References

ab176951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up