Recombinant Human Breast cancer suppressor candidate 1 protein (ab158826)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAF FVFPMDEDSAVYSFEALVDGKKIVAELQDKMKARTNYEKAISQGHQAFLL EGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGALRFVLPAVLN PRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCP LSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPN MKPGHLMGDPSAMVSFYPNIPEDQPSNTCGEFIFLMDRSGSMQSPMSSQD TSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDT FSVIKEVRINRQKHRCFSFGIGEGTSTSLIKGIARASGGTSEFITGKDRM QSKALRTLKRSLQPVVEDVSLSWHLPPGLSAKMLSPEQTVIFRGQRLISY AQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAA KSLLQTKDMGLRETPASDKKDALNLSLESGVISSFTAFIAINKELNKPVQ GPLAHRDVPRPILLGASAPLKIKCQSGFRKALHSDRPPSASQPRGELMCY KAKTFQMDDYSLCGLISHKDQHSPGFGENHLVQLIYHQNANGSWDLNEDL AKILGMSLEEIMAAQPAELVDSSGWATILAVIWLHSNGKDLKCEWELLER KAVAWMRAHAGSTMPSVVKAAITFLKSSVDPAIFAF
    • Amino acids
      1 to 786
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCSC 1
    • BCSC-1
    • BCSC1
    • Breast cancer suppressor candidate 1
    • LHR2A
    • LOH11CR2A
    • Loss of heterozygosity 11 chromosomal region 2 gene A
    • Loss of heterozygosity 11 chromosomal region 2 gene A protein
    • Ortholog of mouse AW551984
    • VMA5A_HUMAN
    • von Willebrand factor A domain containing 5A
    • von Willebrand factor A domain-containing protein 5A
    • Vwa5a
    see all
  • Function
    May play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.
  • Tissue specificity
    Expressed at low level in many tissues. Not expressed in 80% of tumor cell lines tested.
  • Sequence similarities
    Contains 1 VIT domain.
    Contains 1 VWFA domain.
  • Information by UniProt

Images

  • ab158826 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158826 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up