Recombinant Human Brevican protein (ab153477)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPA YPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYR
    • Amino acids
      63 to 162
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153477 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCAN
    • BEHAB
    • Brain enriched hyaluronan binding protein
    • Brevican core protein
    • Brevican core protein isoform 1
    • Brevican core protein isoform 2
    • Brevican proteoglycan
    • Chondroitin sulfate proteoglycan 7
    • Chondroitin sulfate proteoglycan BEHAB
    • CSPG7
    • MGC13038
    see all
  • Relevance
    Brevican is the most abundant chondroitin sulfate proteoglycan in the extracellular matrix of the adult brain. It is a member of the lectican family of aggregating extracellular matrix proteoglycans that bear chondroitin sulfate (CS) chains. It is highly expressed in the central nervous system and is thought to stabilize synapses and inhibit neural plasticity. Brevican is secreted from astrocytes and neurons as a 145 kD core protein that bears up to three, covalently-linked, CS chains. It is also is secreted as a 145 kD core protein without CS chains. When cleaved by extracellular glutamyl endopeptidases, the ADAMTSs, a 55 kD N-terminal fragment is formed that contains the unique C-terminal epitope EAMESE.
  • Cellular localization
    Isoform 1 is secreted, extracellular space, extracellular matrix; Isoform 2 is found on the membrane; Lipid-anchor, GPI-anchor.

Images

  • ab153477 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153477 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153477.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up