Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVSRDQAHLGPKYVGLWDFKSRTDEELSFRAGDVFHVARKEEQWWWATLL DEAGGAVAQGYVPHNYLAERETVESEPWFFGCISRSEAVRRLQAEGNATG AFLIRVSEKPSADYVLSVRDTQAVRHYKIWRRAGGRLHLNEAVSFLSLPE LVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFTLCRKLGSG YFGEVFEGLWKDRVQVAIKVISRDNLLHQQMLQSEIQAMKKLRHKHILAL YAVVSVGDPVYIITELMAKGSLLELLRDSDEKVLPVSELLDIAWQVAEGM CYLESQNYIHRDLAARNILVGENTLCKVGDFGLARLIKEDVYLSHDHNIP YKWTAPEALSRGHYSTKSDVWSFGILLHEMFSRGQVPYPGMSNHEAFLRV DAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENP T
    • Molecular weight
      78 kDa including tags
    • Amino acids
      1 to 451

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Breast tumor kinase
    • Breast tumour kinase
    • Protein tyrosine kinase 6
    • Protein-tyrosine kinase 6
    • Ptk6
    • PTK6_HUMAN
    • Tyrosine protein kinase BRK
    • Tyrosine-protein kinase BRK
    see all
  • Function
    Phosphorylates KHDRBS1, KHDRBS2, KHDRBS3 and STAP2/BKS. May function as an intracellular signal transducer in epithelial tissues. Overexpression in mammary cells leads to mitogenically sensitization to EGF, and results in a partially transformed phenotype. Its presence in the nucleus appears to be linked to suppression of tumor progression.
  • Tissue specificity
    Epithelia-specific. Very high level in colon and high levels in small intestine and prostate, and low levels in some fetal tissues. Expressed at low level in some breast tumors, but not in normal breast. Also found in melanocytes. Not expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. BRK/PTK6/SIK subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    Autophosphorylated. The phosphorylation of Tyr-447 may lead to the autoinhibition of the enzyme.
  • Cellular localization
    Cytoplasm. Nucleus. Colocalizes with KHDRBS1, KHDRBS2 or KHDRBS3, within the nucleus. In secretory epithelial cells from prostate adenocarcinoma, nuclear localization is higher in low-grade and lower in high-grade regions of the tumors.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up