Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASL DETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAH HHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGGGGAHDGPGGG GGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLS HPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVV GAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPG VGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELF NGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVR VWFCNQRQKQKRMKFSATY
    • Molecular weight
      73 kDa including tags
    • Amino acids
      1 to 419

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152626 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Brain specific homeobox/POU domain protein 3A
    • Brain-3A
    • Brain-specific homeobox/POU domain protein 3A
    • Brn 3.0
    • BRN 3A
    • Brn-3A
    • Brn3
    • BRN3A
    • class 4
    • FLJ13449
    • Homeobox/POU domain protein RDC 1
    • Homeobox/POU domain protein RDC-1
    • Homeobox/POU domain protein RDC1
    • Oct T1
    • Oct-T1
    • OctT1
    • PO4F1_HUMAN
    • POU class 4 homeobox 1
    • POU domain
    • POU Domain Class 4 Transcription Factor 1
    • Pou4f1
    • RDC 1
    • RDC1
    • transcription factor 1
    see all
  • Function
    Probable transcription factor which may play a role in the regulation of specific gene expression within a subset of neuronal lineages. May play a role in determining or maintaining the identities of a small subset of visual system neurons.
  • Tissue specificity
    Brain. Seems to be specific to the retina. Present in the developing brain, spinal cord and eye.
  • Sequence similarities
    Belongs to the POU transcription factor family. Class-4 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Developmental stage
    Expression peaks early in embryogenesis (day 13.5) and is undetectable 14 days after birth.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152626 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152626.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up