Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYID GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGA VLDIRYGVSRIAYSKDFETLKVDF LSKLPEMLKMFEDRLCHKTYLNGD HVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKK RIEAIPQIDKYLK SSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSKKNTNKQEM GT YLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKY RSYEEFK ADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLC KNCFYLSNARPD
    • Molecular weight
      41 kDa including tags
    • Amino acids
      150 to 270
    • Tags
      GST tag N-Terminus
    • Additional sequence information
      corresponding to single bromodomain

Specifications

Our Abpromise guarantee covers the use of ab195165 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >= 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.64% Tris HCl, 0.63% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

General Info

  • Alternative names
    • Adenovirus 5 E1A binding protein
    • Bone morphogenetic protein receptor associated molecule 1
    • BRAM1
    • BS69 variant 1
    • BS69 variant 2
    • BS69 variant 3
    • BS69 variant 4
    • RP11-486H9.1
    • Zinc finger MYND domain containing 11
    • zinc finger MYND domain containing protein 11
    • zinc finger, MYND type containing 11
    • ZMYND11
    see all
  • Relevance
    BS69 is a factor previously identified as an adenovirus E1A-associated protein. The protein localizes to the nucleus. It functions as a transcriptional repressor, and expression of E1A inhibits this repression. Two transcript variants encoding different isoforms have been found for this gene.
  • Cellular localization
    Nuclear

Images

  • 4-20% SDS-PAGE using 2 µg ab195165 (Lane 1). Lane 2 shows protein marker.

References

ab195165 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195165.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up