Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSCQCYPKITFVPADSDFQGILSPKAMGL LENGLAAEMKSPSPQPPYVRLWEEAAYDQSLPDFSHIQMKVMSYSEDHRS LLAPEMGQPKLGTSDGGEGGPGDVQAWMEAAVVIHKGSDESEGERRLTQS WPGPLACPQGPAPLASFQDDLDMDSSEGSSPNASPHDREEACSPQQEPQG CRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEA SDTGGEEPEKEEEDLYYGLPDGAGDLLPDKELGFEPDTQG
    • Molecular weight
      32 kDa including tags
    • Amino acids
      54 to 320
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab167848 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • BART
    • Bartter syndrome infantile with sensorineural deafness
    • Bartter syndrome, infantile, with sensorineural deafness (Barttin)
    • Barttin
    • Bsnd
    • BSND_HUMAN
    • deafness, autosomal recessive 73
    • DFNB 73
    • DFNB73
    see all
  • Function
    Functions as a beta-subunit for CLCNKA and CLCNKB chloride channels. In the kidney CLCNK/BSND heteromers mediate chloride reabsorption by facilitating its basolateral efflux. In the stria, CLCNK/BSND channels drive potassium secretion by recycling chloride for the basolateral SLC12A2 cotransporter.
  • Tissue specificity
    Expressed primarily in kidney. Expressed in specific nephron segments and in the stria vascularis of the inner ear.
  • Involvement in disease
    Bartter syndrome 4A
  • Cellular localization
    Cell membrane. Cytoplasm. A significant amount also observed intracellularly. Staining in membranes of the renal tubule and of potassium-secreting epithelia of the inner ear is basolateral.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab167848.

References

ab167848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up