Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ10589
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSEACRDGLRAVMECRNVTHLLQQELTEAQ KGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQ DASAEVERLRRENQVLSVRIADKKYYPSSQDSS
    • Molecular weight15 kDa including tags
    • Amino acids50 to 161
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 80 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Bone marrow stromal antigen 2
    • Bone marrow stromal cell antigen
    • Bone marrow stromal cell antigen 2
    • BST 2
    • BST-2
    • BST2
    • BST2_HUMAN
    • CD 317
    • CD317
    • CD317 antigen
    • HM1.24 antigen
    • NPC A 7
    • Tetherin
    see all
  • FunctionMay be involved in the sorting of secreted proteins (By similarity). May be involved in pre-B-cell growth. Antiretroviral defense protein, that blocks release of retrovirus from the cell surface. Depleted unpon HIV-1 infection by viral VPU protein through 20S proteasome degradation. Depleted upon infection by human Kaposi's sarcoma-associated herpesvirus (KSHV) through ubiquitination and subsequent degradation. May play a role in B-cell activation in rheumatoid arthritis.
  • Tissue specificityPredominantly expressed in liver, lung, heart and placenta. Lower levels in pancreas, kidney, skeletal muscle and brain. Overexpressed in multiple myeloma cells. Highly expressed during B-cell development, from pro-B precursors to plasma cells. Highly expressed on T-cells, monocytes, NK cells and dendritic cells (at protein level).
  • Sequence similaritiesBelongs to the tetherin family.
  • DomainThe extracellular coiled coil domain is important for virus retention at the cell surface and prevention of virus spreading.
  • Post-translational
    modifications
    Monoubiquitinated by KSHV E3 ubiquitin-protein ligase K5, leading to its targeting to late endosomes and degradation.
  • Cellular localizationGolgi apparatus > trans-Golgi network. Cell membrane. Cell membrane. Late endosome. Targeted to late endosomes upon KSHV infection and subsequent ubiquitination. Targeted to the trans-Golgi network by viral VPU protein.
  • Information by UniProt

Recombinant Human BST2 protein images

  • 15% SDS-PAGE analysis of ab109848 (3 µg).

References for Recombinant Human BST2 protein (ab109848)

ab109848 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"