Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANS EACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMA SLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIAD KKYYPSSQDSSSAAAPQLLIVLLGLSALLQ
    • Molecular weight
      46 kDa including tags
    • Amino acids
      1 to 180
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bone marrow stromal antigen 2
    • Bone marrow stromal cell antigen
    • Bone marrow stromal cell antigen 2
    • BST 2
    • BST-2
    • BST2
    • BST2_HUMAN
    • CD 317
    • CD317
    • CD317 antigen
    • HM1.24 antigen
    • NPC A 7
    • Tetherin
    see all
  • Function
    May be involved in the sorting of secreted proteins (By similarity). May be involved in pre-B-cell growth. Antiretroviral defense protein, that blocks release of retrovirus from the cell surface. Depleted unpon HIV-1 infection by viral VPU protein through 20S proteasome degradation. Depleted upon infection by human Kaposi's sarcoma-associated herpesvirus (KSHV) through ubiquitination and subsequent degradation. May play a role in B-cell activation in rheumatoid arthritis.
  • Tissue specificity
    Predominantly expressed in liver, lung, heart and placenta. Lower levels in pancreas, kidney, skeletal muscle and brain. Overexpressed in multiple myeloma cells. Highly expressed during B-cell development, from pro-B precursors to plasma cells. Highly expressed on T-cells, monocytes, NK cells and dendritic cells (at protein level).
  • Sequence similarities
    Belongs to the tetherin family.
  • Domain
    The extracellular coiled coil domain is important for virus retention at the cell surface and prevention of virus spreading.
  • Post-translational
    modifications
    Monoubiquitinated by KSHV E3 ubiquitin-protein ligase K5, leading to its targeting to late endosomes and degradation.
  • Cellular localization
    Golgi apparatus > trans-Golgi network. Cell membrane. Cell membrane. Late endosome. Targeted to late endosomes upon KSHV infection and subsequent ubiquitination. Targeted to the trans-Golgi network by viral VPU protein.
  • Information by UniProt

Images

  • Coomassie blue stained 12.5% SDS page analysis of ab112254

References

ab112254 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112254.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up