Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASLGPAAAGEQASGAEAEPGPAGPPPPPSPSSLGPLLPLQREPLYNWQA TKASLKERFAFLFNSELLSDVRFVLGKGRGAAAAGGPQRIPAHRFVLAAG SAVFDAMFNGGMATTSAEIELPDVEPAAFLALLRFLYSDEVQIGPETVMT TLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCL DTIDKSTMDAISAEGFTDIDIDTLCAVLERDTLSIRESRLFGAVVRWAEA ECQRQQLPVTFGNKQKVLGKALSLIRFPLMTIEEFAAGPAQSGILSDREV VNLFLHFTVNPKPRVEYIDRPRCCLRGKECCINRFQQVESRWGYSGTSDR IRFTVNRRISIVGFGLYGSIHGPTDYQVNIQIIEYEKKQTLGQNDTGFSC DGTANTFRVMFKEPIEILPNVCYTACATLKGPDSHYGTKGLKKVVHETPA ASKTVFFFFSSPGNNNGTSIEDGQIPEIIFYT
    • Amino acids
      1 to 482
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162680 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BTB (POZ) domain containing 1
    • BTB domain containing 1
    • BTB/POZ domain containing protein 1
    • BTBD 1
    • C15orf1
    • HCV NS5A transactivated protein 8
    • Hepatitis C virus NS5A transactivated protein 8
    • NS5ATP8
    see all
  • Relevance
    BTBD1 contains a proline-rich region and a BTB/POZ domain which are typically involved in protein-protein interactions. The C-terminus of BTBD1 binds topoisomerase I and BTBD1 also interacts with TRIM5 isoform Delta. BTBD1 localizes to cytoplasmic bodies and is essential for myogenic differentiation.
  • Cellular localization
    Cytoplasm, P-body. Cytoplasmic bodies.

Images

  • ab162680 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162680 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162680.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up