Overview

  • Product name
    Recombinant Human BTG1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAE HYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPS ELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCK EELLLGRTSPSKNYNMMTVSG
    • Amino acids
      1 to 171
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B cell translocation gene 1 protein
    • B cell translocation gene 1, anti proliferative
    • BTG1 protein
    • Protein BTG1
  • Relevance
    BTG1 belongs to the BTG family of proteins.FUNCTION: Anti-proliferative protein. Its expression is associated with the early G1 phase of the cell cycle. A chromosomal aberration involving BTG1 may be a cause of a form of B cell chronic lymphocytic leukemia; translocation t(8;12)(q24;q22) with MYC.

Images

  • ab157977 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up