Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIF RIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENL CCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
    • Amino acids
      1 to 144
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bud31
    • BUD31 homolog (S. cerevisiae)
    • BUD31_HUMAN
    • Cwc14
    • EDG 2
    • EDG2
    • fSAP17
    • Functional spliceosome associated protein 17
    • G10
    • G10 maternal transcript homolog
    • Maternal G10 transcript
    • Protein BUD31 homolog
    • Protein EDG-2
    • Protein G10 homolog
    • YCR063W
    see all
  • Sequence similarities
    Belongs to the BUD31 (G10) family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160251 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up