Overview

  • Product name
    Recombinant Human BYSL protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTAAGHHAEVVVDPEDERAIEMFMNKNPPARRTLADIIMEKLTEKQTEVE TVMSEVSGFPMPQLDPRVLEVYRGVREVLSKYRSGKLPKAFKIIPALSNW DQILYVTEPEAWTAAAMYQATRIFASNLKERMAQRFYNLVLLPRVRDDVA EYKRLNFHLYMALKKALFKPGAWFKGILIPLCESGTCTLREAIIVGSIIT KCSIPVLHSSAAMLKIAEMEYSGANSIFLRLLLDKKYALPYRVLDALVFH FLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQL SPEIRRELQSAVPRDVEDVPITVE
    • Amino acids
      1 to 324
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • by the ribosomal protein s6 gene drosophila homolog like
    • BYSL
    • BYST_HUMAN
    • Bystin
    • bystin like
    see all
  • Function
    Required for processing of 20S pre-rRNA precursor and biogenesis of 40S ribosomal subunits. May be required for trophinin-dependent regulation of cell adhesion during implantation of human embryos.
  • Tissue specificity
    Found in the placenta from the sixth week of pregnancy. Was localized in the cytoplasm of the syncytiotrophoblast in the chorionic villi and in endometrial decidual cells at the uteroplacental interface. After week 10, the level decreased and then disappeared from placental villi.
  • Sequence similarities
    Belongs to the bystin family.
  • Cellular localization
    Cytoplasm. Nucleus > nucleolus. Associated with 40S ribosomal subunits.
  • Information by UniProt

Images

  • ab157981 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up