Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP10242
    • SpeciesHuman
    • SequenceMARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEK LKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEED QRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEE EDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQ ESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHIS EAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL LLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGE HHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFID SFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQD VIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNFFCSHHWEGDS LNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASP LQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM
    • Molecular weight96 kDa including tags
    • Amino acids1 to 640

Specifications

Our Abpromise guarantee covers the use of ab114406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C myb
    • c myb protein (140 AA)
    • c-myb protein (140 AA)
    • c-myb_CDS
    • c-myb10A_CDS
    • c-myb13A_CDS
    • c-myb14A_CDS
    • c-myb8B_CDS
    • Cmyb
    • efg
    • Myb
    • MYB_HUMAN
    • ONCOGENE AMV
    • Oncogene MYB
    • Proto oncogene c Myb
    • Proto-oncogene c-Myb
    • Transcriptional activator Myb
    • v myb avian myeloblastosis viral oncogene homolog
    • v-myb avian myeloblastosis viral oncogene homolog
    see all
  • FunctionTranscriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.
  • Sequence similaritiesContains 3 HTH myb-type DNA-binding domains.
  • DomainComprised of 3 domains; an N-terminal DNA-binding domain, a centrally located transcriptional activation domain and a C-terminal domain involved in transcriptional repression.
  • Post-translational
    modifications
    Ubiquitinated; mediated by SIAH1 and leading to its subsequent proteasomal degradation.
    Phosphorylated by NLK on multiple sites, which induces proteasomal degradation.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human c-Myb protein images

  • 12.5% SDS-PAGE analysis of ab114406 stained with Coomassie Blue.

References for Recombinant Human c-Myb protein (ab114406)

ab114406 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"