Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEK LKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEED QRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEE EDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQ ESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHIS EAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL LLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGE HHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFID SFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVF RTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQD VIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNFFCSHHWEGDS LNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASP LQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM
    • Molecular weight
      96 kDa including tags
    • Amino acids
      1 to 640

Specifications

Our Abpromise guarantee covers the use of ab114406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C myb
    • c myb protein (140 AA)
    • c-myb protein (140 AA)
    • c-myb_CDS
    • c-myb10A_CDS
    • c-myb13A_CDS
    • c-myb14A_CDS
    • c-myb8B_CDS
    • Cmyb
    • efg
    • Myb
    • MYB proto-oncogene transcription factor
    • MYB_HUMAN
    • ONCOGENE AMV
    • Oncogene MYB
    • Proto oncogene c Myb
    • Proto-oncogene c-Myb
    • Transcriptional activator Myb
    • v myb avian myeloblastosis viral oncogene homolog
    • v-myb avian myeloblastosis viral oncogene homolog
    see all
  • Function
    Transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Plays an important role in the control of proliferation and differentiation of hematopoietic progenitor cells.
  • Sequence similarities
    Contains 3 HTH myb-type DNA-binding domains.
  • Domain
    Comprised of 3 domains; an N-terminal DNA-binding domain, a centrally located transcriptional activation domain and a C-terminal domain involved in transcriptional repression.
  • Post-translational
    modifications
    Ubiquitinated; mediated by SIAH1 and leading to its subsequent proteasomal degradation.
    Phosphorylated by NLK on multiple sites, which induces proteasomal degradation.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab114406 stained with Coomassie Blue.

References

ab114406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up