Recombinant Human C Reactive Protein (denatured) (ab111647)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP02741
    • SpeciesHuman
    • SequenceMQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGY SIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTS WESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGS QSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVF TKPQLWP
    • Molecular weight23 kDa including tags
    • Amino acids19 to 244

Specifications

Our Abpromise guarantee covers the use of ab111647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 12.01% Urea
    Note: Contains 67% Tris-HCl buffer.

General Info

  • Alternative names
    • Pentraxin 1, short
    • C reactive protein
    • C reactive protein pentraxin related
    • C-reactive protein(1-205)
    • CRP
    • CRP_HUMAN
    • MGC88244
    • Pentraxin 1
    • PTX 1
    • PTX1
    see all
  • FunctionDisplays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.
  • Tissue specificityFound in plasma.
  • Sequence similaritiesBelongs to the pentaxin family.
    Contains 1 pentaxin domain.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human C Reactive Protein (denatured) images

  • 15% SDS-PAGE analysis of ab111647 (3 µg)

References for Recombinant Human C Reactive Protein (denatured) (ab111647)

This product has been referenced in:
  • Ko JA & Lim HB Metal-doped inorganic nanoparticles for multiplex detection of biomarkers by a sandwich-type ICP-MS immunoassay. Anal Chim Acta 938:1-6 (2016). Read more (PubMed: 27619081) »

See 1 Publication for this product

Product Wall

Thank you for your reply. I mistakenly typed in another '5' in previous value I gave you. Therefore the number should be 45045M-1 cm-1. Apologies for any confusion that it caused. Also just to reconfirm that you should have received 100ug of protein in...

Read More

Thank you for contacting Abcam. I can confirm that there should have been 100ug protein in the vial that you received (you may have gotten a little more, but not that much). As for you extinction coefficient, using the http://web.expasy.org/cgi-bin/pro...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"