Recombinant Human C10orf63 protein (ab165921)

Overview

  • Product name
    Recombinant Human C10orf63 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDPTCSSECIYNLIPSDLKEPPQPPRYISIFKATVKDDMQKAKTAMKTMG PAKVEVPSPKDFLKKHSKEKTLPPKKNFDRNVPKKPAVPLKTDHPVMGIQ SGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKD YGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGL KKNWEEVHKEFQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKII YIANNA
    • Amino acids
      1 to 256
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chromosome 10 open reading frame 63
    • DKFZp781F21103
    • Enkur
    • ENKUR_HUMAN
    • Enkurin
    • MGC26778
    see all
  • Function
    Adapter that functions to localize a calcium-sensitive signal transduction machinery in sperm to a calcium-permeable ion channel.
  • Sequence similarities
    Contains 1 enkurin domain.
    Contains 1 IQ domain.
  • Domain
    Residues 160-255 contains the TRPC2 binding site.
    The IQ motif is involved in calmodulin binding.
  • Cellular localization
    Cell projection > cilium > flagellum. Sperm acrosomal crescent and flagellar principal piece.
  • Information by UniProt

Images

  • ab165921 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up