Recombinant Human C10orf97 protein (ab164182)

Overview

  • Product name
    Recombinant Human C10orf97 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGP CAVIAPVQAFLLKKLLFSSEKSSWRDCSEEEQKELLCHTLCDILESACCD HSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALAVEELGFERFH ALIQKRSFRSLPELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNE IEDASEPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMKLLGIHE QAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVA PEAPSEQARRVFQTYDPEDNGFIPDSLLEDVMKALDLVSDPEYINLMKNK LDPEGLGIILLGPFLQEFFPDQGSSGPESFTVYHYNGLKQSNYNEKVMYV EGTAVVMGFEDPMLQTDDTPIKRCLQTKWPYIELLWTTDRSPSLN
    • Amino acids
      1 to 445
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C10orf97
    • CARD containing protein
    • CARP
    • Caspase recruitment domain containing pro apoptotic protein
    • Chromosome 10 open reading frame 97
    • Dermal papilla derived protein 5
    • DERP5
    • FAM188A
    • Family with sequence similarity 188, member A
    • MST126
    • MSTP126
    • my042
    • Protein FAM188A
    see all
  • Relevance
    C10ORF97 is a member of the caspase-associated recruitment domain (CARD) family of proteins that play a role in apoptosis. Overexpression of this protein significantly inhibits cell proliferation in several tumor cell lines.
  • Cellular localization
    Nuclear

Images

  • ab164182 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164182 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up