Recombinant Human C11orf82 protein (ab165945)

Overview

  • Product name
    Recombinant Human C11orf82 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNRRRKFLLASVLALQNSSFIYPSCQKCFSRIILVSKRSNCPKCGSTGES GNANYRYKLSLKVAESNKLFVITVFGSCLDTFFGLTATGLHRYIQDPNKI PETLDNDTTQNLLTKAVETCFVGQSFIFGVTNFENQPGQGSDASNFLQQC SDHKRKAKALVACQIVLPDPGIAGFTVIDYFHQLLQTFNFRKLQCDSQAP NNHLLALDHSNSDLSSTYTSDSTSDFFKSCSKDTFSKFWQPSLEFTCIVS QLTDNDDFSASEQSKAFGTLQQNRKSISIAEATGSSSCHDPIQDSWSLVS YMDKKSTAEKLGKELGLQAKELSAVHSSHHEIGVNDSNLFSLEMREPLES SNTKSFHSAVEIKNRSQHELPCFQHHGIDTPTSLQKRSACCPPSLLRLEE TASSSQDGDPQIWDDLPFSESLNKFLAVLESEIAVTQADVSSRKHHVDND IDKFHADHSSLSVTPQRTTGALHTPPIALRSSQVIVKANCSKDDFLFNCK GNLSPSVEKESQPDNKVEAVSVNHNGRDMSEYFLPNPYLSALSSSSKDLE TIVTLKKTIRISPHRESDHSSLNNKYLNGCGEISVSEMNEKLTTLCYRKY NDVSDLCKLENKQYCRWSKNQDDSFTICRKLTYPLETLCNSPNRSTNTLK EMPWGHINNNVTQSYSIGYEGSYDASADLFDDIAKEMDIATEITKKSQDI LLKWGTSLAESHPSESDFSLRSLSEDFIQPSQKLSLQSLSDSRHSRTCSP TPHFQSDSEYNFENSQDFVPCSQSTPISGFHQTRIHGINRAFKKPVFYSD LDGNYEKIRIFPENDKQQASPSCPKNIKTPSQKIRSPIVSGISQPDVFNH YPFAECHETDSDEWVPPTTQKIFPSDMLGFQGIGLGKCLAAYHFPDQQEL PRKKLKHIRQGTNKGLIKKKLKNMLAAVVTKKKTHKYNCKSSGWISKCPD IQVLAAPQLHPILGPDSCSEVKCCLPFSEKGPPSVCETRSAWSPELFS
    • Amino acids
      1 to 998
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165945 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Chromosome 11 open reading frame 82
    • DNA damage induced apoptosis suppressor
    • DNA damage induced apoptosis suppressor protein
    • FLJ13936
    • FLJ25416
    • FLJ38838
    • Nitric oxide inducible gene protein
    • Nitric oxide-inducible gene protein
    • Noxin
    • NOXIN_HUMAN
    see all
  • Function
    Acts as an anti-apoptotic factor and its absence increases cell death under normal and stress conditions. Can induce cell cycle arrest in the G1 or early S phase and this activity is independent of p53/TP53.
  • Cellular localization
    Cytoplasm. Nucleus. Accumulates in the nucleus in response to stress.
  • Information by UniProt

Images

  • ab165945 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165945 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165945.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up