Recombinant Human C13orf24 protein (ab161008)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKT EPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKM
    • Amino acids
      660 to 755
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161008 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C13orf24
    • KIAA1008
    • PIBF
    • PIBF 1
    • PIBF1
    • PIBF1_HUMAN
    • Progesterone immunomodulatory binding factor 1
    • Progesterone induced blocking factor 1
    • Progesterone-induced-blocking factor 1
    • RP11 505F3.1
    see all
  • Function
    Mediator of progesterone that by acting on the phospholipase A2 enzyme interferes with arachidonic acid metabolism, induces a Th2 biased immune response, and by controlling NK activity exerts an anti-abortive effect.
  • Tissue specificity
    Expressed at highest levels in testis. Moderate expression is detected in spleen, thymus, prostate, ovary, small intestine, and colon.
  • Information by UniProt

Images

  • ab161008 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161008 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161008.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up