Recombinant Human C14orf126 protein (ab164978)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFK GADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLK GRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGN RQVLKLDTNGPFTHLIEF
    • Amino acids
      1 to 168
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164978 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C14orf126
    • Chromosome 14 open reading frame 12
    • DTD2_HUMAN
    • FLJ51408
    • MGC9912
    • Probable D-tyrosyl-tRNA(Tyr) deacylase 2
    see all
  • Function
    Hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr). Could be a defense mechanism against a harmful effect of D-tyrosine.
  • Sequence similarities
    Belongs to the DTD family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab164978 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164978 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164978.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up