Recombinant Human C14orf166 protein (ab87864)

Overview

  • Product nameRecombinant Human C14orf166 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRN IHS SDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEK YKDLVPDN SKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRH DDYLVMLKAIRIL VQERLTQDAVAKANQTKEGLPVALDKHILGFDTGD AVLNEAAQILRLLHIEEL RELQTKINEAIVAVQAIIADPKTDHRLGKV GR

Associated products

Specifications

Our Abpromise guarantee covers the use of ab87864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • C14orf166
    • CGI 99
    • CGI-99
    • CGI99
    • Chromosome 14 open reading frame 166
    • CLE
    • CLE7
    • CN166_HUMAN
    • Homeobox prox 1
    • LCRP369
    • RLL motif containing 1
    • RLLM1
    • UPF0568 protein C14orf166
    see all
  • Tissue specificityWidely expressed. Expressed at high level in heart and skeletal muscle. Expressed at intermediate level in liver, pancreas, fetal brain and fetal lung. Weakly expressed in adult brain, adult lung, placenta, fetal liver and fetal kidney. Overexpressed in many brain tumors.
  • Sequence similaritiesBelongs to the UPF0568 family.
  • Cellular localizationNucleus. Cytoplasm > perinuclear region. Cytoplasm > cytoskeleton > centrosome. May localize at the centrosome during mitosis.
  • Information by UniProt

References for Recombinant Human C14orf166 protein (ab87864)

ab87864 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"