Recombinant Human C14orf169 / NO66 protein (ab164082)

Overview

  • Product name
    Recombinant Human C14orf169 / NO66 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDGLQASAGPLRRGRPRRRRKPQPHSGSVLALPLRSRKIRKQLRSVVSRM AALRTQTLPSENSEESRVESTADDLGDALPGGAAVAAVPDAARREPYGHL GPAELLEASPAARSLQTPSARLVPASAPPARLVEVPAAPVRVVETSALLC TAQHLAAVQSSGAPATASGPQVDNTGGEPAWDSPLRRVLAELNRIPSSRR RAARLFEWLIAPMPPDHFYRRLWEREAVLVRRQDHTYYQGLFSTADLDSM LRNEEVQFGQHLDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLC PQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQ LEGRKLWRVYRPRAPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFP RGFIHQAECQDGVHSLHLTLSTYQRNTWGDFLEAILPLAVQAAMEENVEF RRGLPRDFMDYMGAQHSDSKDPRRTAFMEKVRVLVARLGHFAPVDAVADQ RAKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVGAQLTTETEVHM LQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLG SYPEFVRVGDLPCDSVEDQLSLATTLYDKGLLLTKMPLALN
    • Amino acids
      1 to 641
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 60S ribosomal protein L8 histidine hydroxylase
    • C14orf169
    • Chromosome 14 open reading frame 169
    • Histone lysine demethylase NO66
    • hsNO66
    • Hypothetical protein FLJ21802
    • Lysine-specific demethylase NO66
    • MAPJD
    • MYC associated protein with JmjC domain
    • NO66
    • NO66_HUMAN
    • Nucleolar protein 66
    • Ribosomal oxygenase NO66
    • ROX
    • Up regulated in lung cancer 2
    • URLC2
    see all
  • Function
    Histone demethylase that specifically demethylates 'Lys-4' (H3K4me) and 'Lys-36' (H3K36me) of histone H3, thereby playing a central role in histone code. Preferentially demethylates trimethylated H3 'Lys-4' (H3K4me3) and monomethylated H3 'Lys-4' (H3K4me1) residues, while it has weaker activity for dimethylated H3 'Lys-36' (H3K36me2). Acts as a regulator of osteoblast differentiation via its interaction with SP7/OSX by demethylating H3K4me and H3K36me, thereby inhibiting SP7/OSX-mediated promoter activation (By similarity). May also play a role in ribosome biogenesis and in the replication or remodeling of certain heterochromatic region.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the MINA53/NO66 family. NO66 subfamily.
    Contains 1 JmjC domain.
  • Cellular localization
    Nucleus > nucleolus. Nucleus > nucleoplasm. Granular part of nucleoli. Nucleoplasm, nucleoplasmic foci, some of them associated with nucleoli.
  • Information by UniProt

Images

  • ab164082 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up