Recombinant Human C14orf172 protein (ab165080)

Overview

  • Product name
    Recombinant Human C14orf172 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLI GRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLE LRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQE HRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEG GRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDL GTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG
    • Amino acids
      1 to 289
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165080 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adenine N
    • C14orf172
    • Chromosome 14 open reading frame 172
    • GCD14
    • Gcd14p
    • hTRM61
    • TRM61
    • tRNA
    • tRNA (adenine N (1) ) m1A58methyltransferase subunit TRM61
    • tRNA (adenine(58) N(1)) methyltransferase catalytic subunit TRMT61A
    • tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRM61
    • tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRMT61A
    • tRNA (m1A58)MTase subunit TRM61
    • tRNA (m1A58T) methyltransferase subunit TRM61
    • tRNA methyltransferase 61 homolog A (S. cerevisiae)
    • tRNA(m1A58)-methyltransferase subunit TRM61
    • tRNA(m1A58)-methyltransferase subunit TRMT61A
    • tRNA(m1A58)MTase subunit TRMT61A
    see all
  • Relevance
    C14orf172 catalyzes the formation of 1-N-methyladenine at position 58 (m1A58) in initiator methionyl-tRNA. There are two known isoforms.
  • Cellular localization
    Nuclear

Images

  • ab165080 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165080 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165080.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up