Recombinant Human C17orf66 protein (ab166070)

Overview

  • Product name
    Recombinant Human C17orf66 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAYEKSTDISDVSRSMFLYPWLEYPDKTKELRKAMAPVHLPLSCYQMPKE EFPPSPECWRQHPSKPNSVPYCYFKKPEIYTHWHDLYDQREEREAEKMLR KMRDDCRYIKEVHQTHIKMFHLPMSKLTIKSEMRSRPLEPTQDPLKWQRL RELTKSLESPREDEQFYAAQALGCLRISDKFVMEALQQVVSLRTAGVQER RKQGLRCVACGHRRGSPGC
    • Amino acids
      1 to 219
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C17orf66
    • chromosome 17 open reading frame 66
    • FLJ32830
    • hypothetical protein LOC256957
    • Uncharacterized protein C17orf66
    see all
  • Relevance
    C17orf66, also known as chromosome 17 open reading frame 66 is an uncharacterized protein. Two isoforms can be produce by alternative splicing. Isoform 1 is designated the canonical sequence and is 66 kDa and 570 amino acids in size. Isoform 2 is 26 kDa and 219 amino acids in size.

Images

  • ab166070 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166070 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166070.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up