Recombinant Human C18orf10 protein (ab171590)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMEEEASSPGLGCSKPHLEKLTLGITRI LESSPGVTEVTIIEKPPAERHMISSWEQKNNCVMPEDVKNFYLMTNGFHM TWSVKLDEHIIPLGSMAINSISKLTQLTQSSMYSLPNAPTLADLEDDTHE ASDDQPEKPHFDSRSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLD RALYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKP ITYNTNLLTEETDSFVNKLDPSKVFKSKNKIVIPKKKGPVQPAGGQKGPS GPSGPSTSSTSKSSSGSGNPTRK
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 300
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab171590 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 0.06% EDTA, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • C18orf10
    • C18orf10 chromosome 18 open reading frame 10
    • Chromosome 18 open reading frame 10
    • DKFZP586M1523
    • HMFN0601
    • HsT3006
    • L17
    • PGs2
    • TPGS2_HUMAN
    • Tubulin polyglutamylase complex subunit 2
    see all
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171590 at 3µg.

References

ab171590 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up