Recombinant Human C19orf80 protein (ab191973)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLY GRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVA QAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHV QRQRREMVAQQHRLRQIQERLHTAALPALEHHHHHH
    • Molecular weight
      21 kDa including tags
    • Amino acids
      22 to 198
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.87% Sodium chloride, 0.24% Tris

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • Angiopoietin-like protein 8
    • ANGPTL8
    • betatrophin
    • Chromosome 19 open reading frame 80
    • hepatocellular carcinoma-associated gene TD26
    • Hepatocellular carcinoma-associated protein TD26
    • Lipasin
    • PRO1185
    • PVPA599
    • RIFL
    • TD26
    • TD26_HUMAN
    • UNQ599
    • UNQ599/PRO1185
    see all
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab191973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up