Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPL EQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEI TDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS
    • Amino acids
      1 to 141
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110036E10Rik
    • AI875855
    • C1D
    • C1D DNA binding protein
    • C1D_HUMAN
    • hC1D
    • LRP1
    • MGC12261
    • MGC14659
    • MGC188504
    • Nuclear DNA binding protein
    • Nuclear nucleic acid binding protein C1D
    • Nuclear nucleic acid-binding protein C1D
    • rCG23324
    • RGD1560600
    • Small unique nuclear receptor corepressor
    • SUNCOR
    see all
  • Function
    Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB.
  • Tissue specificity
    Ubiquitous. Expressed at very high levels in the hippocampus, medulla oblongata, mammary gland, thyroid and salivary gland. Expressed at high levels in the fetal; lung, liver and kidney. Expressed at low levels in skeletal muscle, appendix, heart, lung and colon.
  • Sequence similarities
    Belongs to the C1D family.
  • Post-translational
    modifications
    Phosphorylated by PRKDC.
  • Cellular localization
    Cytoplasm. Nucleus > nucleolus. EXOSC10 is required for nucleolar localization.
  • Information by UniProt

Images

  • ab160994 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160994 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160994.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up