Recombinant Human C1GALT1 protein (ab163426)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDS TTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP
    • Amino acids
      264 to 363
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B3Gal T8
    • Beta 1 3 galactosyltransferase
    • C1GALT
    • Core 1 beta1 3 galactosyltransferase 1
    • Core 1 beta3 Gal T
    • Core 1 O glycan T synthase
    • Core 1 synthase glycoprotein N acetylgalactosamine 3 beta galactosyltransferase 1
    • Core 1 UDP galactose:N acetylgalactosamine alpha R beta 1 3 galactosyltransferase
    • Glycoprotein N acetylgalactosamine 3 beta galactosyltransferase 1
    • T synthase
    see all
  • Relevance
    C1GALT1 (Core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1) is a glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is synthesized by the transfer of Gal from UDP-Gal to GalNAc-alpha-1-R. Core 1 is a precursor for many extended O-glycans in glycoproteins. C1GALT1 plays a central role in many processes, such as angiogenesis, thrombopoiesis and kidney homeostasis development.
  • Cellular localization
    Membrane; Single-pass type II membrane protein.

Images

  • ab163426 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up