Recombinant Human C1orf124 protein (ab164466)

Overview

  • Product name
    Recombinant Human C1orf124 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDDDLMLALRLQEEWNLQEAERDHAQESLSLVDASWELVDPTPDLQALFV QFNDQFFWGQLEAVEVKWSVRMTLCAGICSYEGKGGMCSIRLSEPLLKLR PRKDLVETLLHEMIHAYLFVTNNDKDREGHGPEFCKHMHRINSLTGANIT VYHTFHDEVDEYRRHWWRCNGPCQHRPPYYGYVKRATNREPSAHDYWWAE HQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLAAENKDKPNRGEAQLV IPFSGKGYVLGETSNLPSPGKLITSHAINKTQDLLNQNHSANAVRLNSKI KVKFEQNGSSKNSHLVSPAVSNSHQNVLSNYFPRVSFANQKAFRGVNGSP RISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGS EDTFPNKRPRLEDKTVFDNFFIKKEQIKSSGNDPKYSTTTAQNSSSSSSQ SKMVNCPVCQNEVLESQINEHLDWCLEGDSIKVKSEESL
    • Amino acids
      1 to 489
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C1orf124
    • CA124_HUMAN
    • Chromosome 1 open reading frame 124
    • DDDL1880
    • dJ876B10.3
    • PRO4323
    • RP5-876B10.3
    • Spartan
    • SprT-like domain at the N terminus
    • SprT-like N-terminal domain
    • Zinc finger RAD18 domain-containing protein C1orf124
    see all
  • Sequence similarities
    Contains 1 UBZ-type zinc finger.
  • Information by UniProt

Images

  • ab164466 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up